Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hint2 Peptide - middle region

Hint2 Peptide - middle region

Product Specifications

Product Name Alternative

1190005L05Rik

UniProt

Q9D0S9

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hint2 Rabbit Polyclonal Antibody (orb584625) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_081147

Preservative

Lyophilized powder

AA Sequence

VIPRKPIPRISQAEEDDQQLLGHLLLVAKKIAQAQGLKDGYRLVVNDGKM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PD-1/PDCD1 Antibody Picoband®, APC Conjugate
A00178-APC 100 µg/Vial

Anti-PD-1/PDCD1 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
TNFSF12 Antibody
OACD07895-100UL 100 µL

TNFSF12 Antibody

Sign In for Pricing
View Details
IGHV3OR16-7 sgRNA CRISPR Lentivector (Human) (Target 1)
K1041702 1.0 µg DNA

IGHV3OR16-7 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
RGD1309922 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6082808 1.0 µg DNA

RGD1309922 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
(-) -Denudatin B
TN3831-01 50 mg

(-) -Denudatin B

Sign In for Pricing
View Details
(-) -Denudatin B
TN3831-02 1 mg

(-) -Denudatin B

Sign In for Pricing
View Details