Dcun1d4 Peptide - middle region
Dcun1d4 Peptide - middle region
Product Specifications
Product Name Alternative
AI836376, MGC117952
UniProt
Q8CCA0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Dcun1d4 Rabbit Polyclonal Antibody (orb584706) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_849227
Preservative
Lyophilized powder
AA Sequence
FDFAREKDQRSLDINTAKCMLGLLLGKIWPLFPVFHQFLEQSKYKVINKD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
VAng-Lsx7199-50gEcoli 50 µg (E. coli)
Recombinant Chlamydophila Trachomatis rpsH Protein (aa 1-133) (strain D/UW-3/Cx)
Sign In for Pricing
View Details LV633446 1.0 µg DNA
Olr1542 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
Sign In for Pricing
View Details MBS6422891-01 0.1 mL
Integrin alpha 2B (ITGA2B, GT, GTA, CD41, GP2B, HPA3, CD41B, GPIIb, BDPLT2, BDPLT16) (FITC)
Sign In for Pricing
View Details