Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dcun1d4 Peptide - middle region

Dcun1d4 Peptide - middle region

Product Specifications

Product Name Alternative

AI836376, MGC117952

UniProt

Q8CCA0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dcun1d4 Rabbit Polyclonal Antibody (orb584706) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_849227

Preservative

Lyophilized powder

AA Sequence

FDFAREKDQRSLDINTAKCMLGLLLGKIWPLFPVFHQFLEQSKYKVINKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N6- (2- Aminoethyl) adenosine- 3', 5'- cyclic monophosphorothioate, Sp- isomer, immobilized on agarose (Sp-6-AE-cAMPS-Agarose)
A 109-06 0.6 mL

N6- (2- Aminoethyl) adenosine- 3', 5'- cyclic monophosphorothioate, Sp- isomer, immobilized on agarose (Sp-6-AE-cAMPS-Agarose)

Sign In for Pricing
View Details
DSU Rabbit Polyclonal Antibody (BF488)
orb2514723 100 µL

DSU Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Cryaa sgRNA CRISPR Lentivector (Rat) (Target 1)
K6795402 1.0 µg DNA

Cryaa sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Porcine AN1-type zinc finger protein 5 (ZFAND5) ELISA Kit
MBS7232937-01 48 Well

Porcine AN1-type zinc finger protein 5 (ZFAND5) ELISA Kit

Sign In for Pricing
View Details
Porcine AN1-type zinc finger protein 5 (ZFAND5) ELISA Kit
MBS7232937-02 96 Well

Porcine AN1-type zinc finger protein 5 (ZFAND5) ELISA Kit

Sign In for Pricing
View Details
Porcine AN1-type zinc finger protein 5 (ZFAND5) ELISA Kit
MBS7232937-03 5x 96 Well

Porcine AN1-type zinc finger protein 5 (ZFAND5) ELISA Kit

Sign In for Pricing
View Details