Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Whsc2 Peptide - C-terminal region

Whsc2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NELFA, Whsc2h

UniProt

Q8BG30

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Whsc2 Rabbit Polyclonal Antibody (orb584846) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036044

Preservative

Lyophilized powder

AA Sequence

TPPAPPSREASRPPEEPSAPSPTLPTQFKQRAPMYNSGLSPATPAPAAPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Solanum lycopersicum ATP synthase subunit b, chloroplastic (atpF), partial
MBS7076425 Inquire

Recombinant Solanum lycopersicum ATP synthase subunit b, chloroplastic (atpF), partial

Sign In for Pricing
View Details
Olfr1137 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
32612124 3x 1.0µg DNA

Olfr1137 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
PDE1A Rabbit Polyclonal Antibody (BF680)
orb2371383 100 µL

PDE1A Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Porcine DAF (Decay Accelerating Factor) ELISA Kit
MBS2513733-01 24 Tests

Porcine DAF (Decay Accelerating Factor) ELISA Kit

Sign In for Pricing
View Details
Porcine DAF (Decay Accelerating Factor) ELISA Kit
MBS2513733-02 48 Tests

Porcine DAF (Decay Accelerating Factor) ELISA Kit

Sign In for Pricing
View Details
Porcine DAF (Decay Accelerating Factor) ELISA Kit
MBS2513733-03 96 Tests

Porcine DAF (Decay Accelerating Factor) ELISA Kit

Sign In for Pricing
View Details