Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Whsc2 Peptide - C-terminal region

Whsc2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NELFA, Whsc2h

UniProt

Q8BG30

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Whsc2 Rabbit Polyclonal Antibody (orb584846) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036044

Preservative

Lyophilized powder

AA Sequence

TPPAPPSREASRPPEEPSAPSPTLPTQFKQRAPMYNSGLSPATPAPAAPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C2orf47 ORF Vector (Human) (pORF)
14406011 1.0 µg DNA

C2orf47 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
PITPNA (Phosphatidylinositol Transfer Protein alpha isoform, PI-TP-alpha, PtdIns Transfer Protein alpha, PtdInsTP alpha, PITPNA, PITPN) (PE)
MBS6458163-01 0.2 mL

PITPNA (Phosphatidylinositol Transfer Protein alpha isoform, PI-TP-alpha, PtdIns Transfer Protein alpha, PtdInsTP alpha, PITPNA, PITPN) (PE)

Sign In for Pricing
View Details
PITPNA (Phosphatidylinositol Transfer Protein alpha isoform, PI-TP-alpha, PtdIns Transfer Protein alpha, PtdInsTP alpha, PITPNA, PITPN) (PE)
MBS6458163-02 5x 0.2 mL

PITPNA (Phosphatidylinositol Transfer Protein alpha isoform, PI-TP-alpha, PtdIns Transfer Protein alpha, PtdInsTP alpha, PITPNA, PITPN) (PE)

Sign In for Pricing
View Details
Desoxyrhaponticin
300180 20 mg

Desoxyrhaponticin

Sign In for Pricing
View Details
Txndc5 (NM_001289599) Mouse Untagged Clone
MC227165 10 µg

Txndc5 (NM_001289599) Mouse Untagged Clone

Sign In for Pricing
View Details
Mouse Phosphoglycerate Mutase 1, Brain (PGAM1) Antibody Pair Kit (with Standard)
MBS2090331-01 5x 96 Tests

Mouse Phosphoglycerate Mutase 1, Brain (PGAM1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details