Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Whsc2 Peptide - C-terminal region

Whsc2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NELFA, Whsc2h

UniProt

Q8BG30

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Whsc2 Rabbit Polyclonal Antibody (orb584846) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036044

Preservative

Lyophilized powder

AA Sequence

TPPAPPSREASRPPEEPSAPSPTLPTQFKQRAPMYNSGLSPATPAPAAPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCS- Alpha-1 Antibody : HRP (OAAF05766-HRP)
OAAF05766-100UG-HRP 100 µg

GCS- Alpha-1 Antibody : HRP (OAAF05766-HRP)

Sign In for Pricing
View Details
CEAcam8 Rabbit pAb, PE-Cy7 conjugated
orb2890411 100 µL

CEAcam8 Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
Phospho-Vimentin-S83 Rabbit pAb
E45R29300N-100 100 µL

Phospho-Vimentin-S83 Rabbit pAb

Sign In for Pricing
View Details
Human Disks large-associated protein 3, DLGAP3 ELISA KIT
ELI-47132h 96 Tests

Human Disks large-associated protein 3, DLGAP3 ELISA KIT

Sign In for Pricing
View Details
PHD1 Recombinant Antibody, FITC Conjugated
bsm-61110R-FITC-TR 20 µL

PHD1 Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details
CHST4 Antibody (C-term)
E45R33120G-4 50 µL

CHST4 Antibody (C-term)

Sign In for Pricing
View Details