C1orf38 Peptide - C-terminal region
C1orf38 Peptide - C-terminal region
Product Specifications
Product Name Alternative
ICB-1, THEMIS2, C1orf38
UniProt
Q5TEJ8
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C1orf38 Rabbit Polyclonal Antibody (orb585278) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001099026
Preservative
Lyophilized powder
AA Sequence
RRRPREFPTAYDLLGAFQPGRPLRVVATKDCEGEREENPEFTSLAVGDRL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880026-100 1x 100 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041983-500 1x 500 µL
Carcinoembryonic Antigen (CEA) / CD66 (C66/1983R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042807-100 1x 100 µL
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2807), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882053-500 1x 500 µL
Nucleophosmin (Acute Myeloid Leukemia Marker) (NA24), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400863-500 1x 500 µL
Glypican-3 (GPC3/863), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details