Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CALN1 Peptide - C-terminal region

CALN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CABP8

UniProt

Q9BXU9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CALN1 Rabbit Polyclonal Antibody (orb326425) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113656

Preservative

Lyophilized powder

AA Sequence

LTMKDIENIIINEEESLNETSGNCQTEFEGVHSQKQNRQTCVRKSLICAF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse COL4 (Collagen Type IV) CLIA Kit
E-CL-M0214-01 24 Tests

Mouse COL4 (Collagen Type IV) CLIA Kit

Sign In for Pricing
View Details
Mouse COL4 (Collagen Type IV) CLIA Kit
E-CL-M0214-02 48 Tests

Mouse COL4 (Collagen Type IV) CLIA Kit

Sign In for Pricing
View Details
Mouse COL4 (Collagen Type IV) CLIA Kit
E-CL-M0214-03 96 Tests

Mouse COL4 (Collagen Type IV) CLIA Kit

Sign In for Pricing
View Details
Lincomycin-d3
TRC-L466202-5MG 5 mg

Lincomycin-d3

Sign In for Pricing
View Details
RASSF2 Rabbit Polyclonal Antibody
TA362745 100 µL

RASSF2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2453), Biotin conjugate, 0.1mg/mL
BNCB2453-100 1x 100 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2453), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details