Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CALN1 Peptide - C-terminal region

CALN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CABP8

UniProt

Q9BXU9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CALN1 Rabbit Polyclonal Antibody (orb326425) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113656

Preservative

Lyophilized powder

AA Sequence

LTMKDIENIIINEEESLNETSGNCQTEFEGVHSQKQNRQTCVRKSLICAF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp219 (ZNF219) (NM_001102454) Human Over-expression Lysate
LC420152 20 µg

Zfp219 (ZNF219) (NM_001102454) Human Over-expression Lysate

Sign In for Pricing
View Details
FASTKD5 Human Gene Knockout Kit (CRISPR)
KN400817 1 Kit

FASTKD5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Unconjugated Rabbit Anti-Con A Antibody
AL-1104-2 2 mL

Unconjugated Rabbit Anti-Con A Antibody

Sign In for Pricing
View Details
Vortex Mixer BVMX-404
BVMX-404 1 Unit

Vortex Mixer BVMX-404

Sign In for Pricing
View Details
PPM1M (NM_001122870) Human Over-expression Lysate
LC426581 20 µg

PPM1M (NM_001122870) Human Over-expression Lysate

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (N/A), Biotin conjugate, 0.1mg/mL
BNCB1826-100 1x 100 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (N/A), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details