Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF8 Peptide - middle region

FGF8 Peptide - middle region

Product Specifications

Product Name Alternative

AIGF, HBGF-8, KAL6, MGC149376, FGF-8

UniProt

P55075

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FGF8 Rabbit Polyclonal Antibody (orb585560) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_149354

Preservative

Lyophilized powder

AA Sequence

LIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eltd1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6964005 3x 1.0 µg

Eltd1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
PDE10A Polyclonal Antibody
E-AB-91217-01 60 µL

PDE10A Polyclonal Antibody

Sign In for Pricing
View Details
PDE10A Polyclonal Antibody
E-AB-91217-02 120 µL

PDE10A Polyclonal Antibody

Sign In for Pricing
View Details
PDE10A Polyclonal Antibody
E-AB-91217-03 200 µL

PDE10A Polyclonal Antibody

Sign In for Pricing
View Details
ARHGAP21 sgRNA CRISPR Lentivector set (Human)
K0116101 3x 1.0 µg

ARHGAP21 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Elf-5 Rabbit Polyclonal Antibody
APRab10403-01 20 µL

Elf-5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details