Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNN Peptide - N-terminal region

TNN Peptide - N-terminal region

Product Specifications

Product Name Alternative

TN-W

UniProt

Q9UQP3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TNN Rabbit Polyclonal Antibody (orb585565) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071376

Preservative

Lyophilized powder

AA Sequence

LLVASAPATLEPPGCSNKEQQVTVSHTYKIDVPKSALVQVDADPQPLSDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Got1l1 shRNA (UAS) - Lentiviral mouse Got1l1 shRNA (UAS, iRFP) plasmid
GTR15278560 1 Vial

Lentiviral mouse Got1l1 shRNA (UAS) - Lentiviral mouse Got1l1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Vmn2r118 ORF Vector (Mouse) (pORF)
49747014 1.0 µg DNA

Vmn2r118 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
SEC13 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
43285156 3x 1.0 µg DNA

SEC13 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
ANKZF1 siRNA (Rat)
CRR6182-01 15 nmol

ANKZF1 siRNA (Rat)

Sign In for Pricing
View Details
ANKZF1 siRNA (Rat)
CRR6182-02 30 nmol

ANKZF1 siRNA (Rat)

Sign In for Pricing
View Details
ZNF426 (NM_001300883) Human Tagged ORF Clone
RG238676 10 µg

ZNF426 (NM_001300883) Human Tagged ORF Clone

Sign In for Pricing
View Details