Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNN Peptide - N-terminal region

TNN Peptide - N-terminal region

Product Specifications

Product Name Alternative

TN-W

UniProt

Q9UQP3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TNN Rabbit Polyclonal Antibody (orb585565) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071376

Preservative

Lyophilized powder

AA Sequence

LLVASAPATLEPPGCSNKEQQVTVSHTYKIDVPKSALVQVDADPQPLSDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr887 shRNA Plasmid (m)
sc-151205-SH 20 µg

Olfr887 shRNA Plasmid (m)

Sign In for Pricing
View Details
BTLA Recombinant Antibody [HMBT-6B2] (OAAV00467)
OAAV00930-200UG 200 µg

BTLA Recombinant Antibody [HMBT-6B2] (OAAV00467)

Sign In for Pricing
View Details
Oxamyl
TRC-O845140-10G 10 g

Oxamyl

Sign In for Pricing
View Details
Mouse Monoclonal HIF-1 alpha Antibody (H1alpha 67-7) - Azide and BSA Free
NBP2-80761 0.1 mL

Mouse Monoclonal HIF-1 alpha Antibody (H1alpha 67-7) - Azide and BSA Free

Sign In for Pricing
View Details
HEP G2 Whole Cell Lysate (Hepatoblastoma cells)
HEPG2-50 50 ug

HEP G2 Whole Cell Lysate (Hepatoblastoma cells)

Sign In for Pricing
View Details
ZDHHC4P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV790099 1.0 µg DNA

ZDHHC4P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details