COQ9 Peptide - N-terminal region
COQ9 Peptide - N-terminal region
Product Specifications
Product Name Alternative
C16orf49, DKFZp434K046
UniProt
O75208
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with COQ9 Rabbit Polyclonal Antibody (orb585618) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_064708
Preservative
Lyophilized powder
AA Sequence
ASAVGLRSSDEQKQQPPNSFSQQHSETQGAEKPDPESSHSPPRYTDQGGE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![RPB3 Recombinant Rabbit Monoclonal Antibody [JE34-81]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea8286b/imageurl/ha722448.webp)
HA722448 100 µL
RPB3 Recombinant Rabbit Monoclonal Antibody [JE34-81]
Sign In for Pricing
View Details ![LSM11 Mouse Monoclonal Antibody [Clone ID: OTI3G8]](https://cdn.genprice.uk/products/937/68dd18bb061270361e9088f7/imageurl/cf809995.webp)
TP318057M 100 µg
IL17 (IL17A) (NM_002190) Human Recombinant Protein
Sign In for Pricing
View Details 
BNC682505-100 1x 100 µL
CD73 (Immuno-Oncology Target) (NT5E/2505), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
