COQ9 Peptide - N-terminal region
COQ9 Peptide - N-terminal region
Product Specifications
Product Name Alternative
C16orf49, DKFZp434K046
UniProt
O75208
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with COQ9 Rabbit Polyclonal Antibody (orb585618) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_064708
Preservative
Lyophilized powder
AA Sequence
ASAVGLRSSDEQKQQPPNSFSQQHSETQGAEKPDPESSHSPPRYTDQGGE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP50359PU-N 400 µL
bcl 6 (BCL6) (C-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details ![Influenza A H3N2 (Haemagglutinin) Mouse Monoclonal Antibody [Clone ID: AT1B7]](https://cdn.genprice.uk/products/937/68dd189e061270361e8fd6b0/imageurl/am50009pu-n.webp)
AM50009PU-N 100 µL
Influenza A H3N2 (Haemagglutinin) Mouse Monoclonal Antibody [Clone ID: AT1B7]
Sign In for Pricing
View Details 
BNC881297-500 1x 500 µL
HPV-18 (Human Papilloma Virus 18) (HPV18/1297), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details