Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCNB2 Peptide - C-terminal region

CCNB2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HsT17299

UniProt

O95067

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCNB2 Rabbit Polyclonal Antibody (orb585634) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004692

Preservative

Lyophilized powder

AA Sequence

VLEVMQHMAKNVVKVNENLTKFIAIKNKYASSKLLKISMIPQLNSKAVKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Enibarcimab Biosimilar - Research Grade
ICH5134-100mg 100 mg

Enibarcimab Biosimilar - Research Grade

Sign In for Pricing
View Details
PLEKHA1 (NM_001001974) Human Over-expression Lysate
LY424303 100 µg

PLEKHA1 (NM_001001974) Human Over-expression Lysate

Sign In for Pricing
View Details
NUDT19 Rabbit Polyclonal Antibody
TA371794 100 µL

NUDT19 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: left
CS710988 5x 5 µm

Tissue FFPE Sections, Colon: left

Sign In for Pricing
View Details
Annexin V, CF®700 Conjugate (azide-free, lyophilized)
#29082 1x 25 µg

Annexin V, CF®700 Conjugate (azide-free, lyophilized)

Sign In for Pricing
View Details
Elab Bright™ Violet 510 Anti-Mouse/Human CD11b Antibody[M1/70]
E-AB-F1081R1 50 Tests

Elab Bright™ Violet 510 Anti-Mouse/Human CD11b Antibody[M1/70]

Sign In for Pricing
View Details