Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCNB2 Peptide - C-terminal region

CCNB2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HsT17299

UniProt

O95067

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCNB2 Rabbit Polyclonal Antibody (orb585634) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004692

Preservative

Lyophilized powder

AA Sequence

VLEVMQHMAKNVVKVNENLTKFIAIKNKYASSKLLKISMIPQLNSKAVKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (Late Endosomes Marker) (LAMP3/2790), CF740 conjugate, 0.1mg/mL
BNC742790-500 1x 500 µL

CD63 (Late Endosomes Marker) (LAMP3/2790), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LRG1 Rabbit Polyclonal Antibody
AP17538PU-N 400 µL

LRG1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Carnosine Dipeptidase 1 (CNDP1) ELISA Kit
RDR-CNDP1-Hu-01 96 Tests

Human Carnosine Dipeptidase 1 (CNDP1) ELISA Kit

Sign In for Pricing
View Details
Human Carnosine Dipeptidase 1 (CNDP1) ELISA Kit
RDR-CNDP1-Hu-02 48 Tests

Human Carnosine Dipeptidase 1 (CNDP1) ELISA Kit

Sign In for Pricing
View Details
2,2'-Dichloro Diphenyl Disulfide
TRC-D434545-5G 5 g

2,2'-Dichloro Diphenyl Disulfide

Sign In for Pricing
View Details
Neuroserpin (SERPINI1) Rabbit Polyclonal Antibody
AP01329PU-N 100 µg

Neuroserpin (SERPINI1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details