Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFRC Peptide - N-terminal region

TFRC Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD71, TFR, TFR1, TRFR, T9, TR, p90

UniProt

P02786

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TFRC Rabbit Polyclonal Antibody (orb333739) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003225

Preservative

Lyophilized powder

AA Sequence

PVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rras 3'UTR GFP Stable Cell Line
TU269730 1.0 mL

Rras 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rabbit Polyclonal PTRH2 Antibody
NBP3-12579-100ul 100 µL

Rabbit Polyclonal PTRH2 Antibody

Sign In for Pricing
View Details
Ncaph ORF Vector (Mouse) (pORF)
ORF051079 1.0 µg DNA

Ncaph ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
ZBTB25 Polyclonal Antibody, Biotin Conjugated
bs-13568R-Biotin 100 µL

ZBTB25 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
2-Chloro-N- (2,3-dihydro-1,1-dioxido-3-thienyl) acetamide
orb3143496 1 mg

2-Chloro-N- (2,3-dihydro-1,1-dioxido-3-thienyl) acetamide

Sign In for Pricing
View Details
C7orf46 (FAM221A) (NM_199136) Human Tagged Lenti ORF Clone
RC209387L3 10 µg

C7orf46 (FAM221A) (NM_199136) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details