Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFRC Peptide - N-terminal region

TFRC Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD71, TFR, TFR1, TRFR, T9, TR, p90

UniProt

P02786

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TFRC Rabbit Polyclonal Antibody (orb333739) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003225

Preservative

Lyophilized powder

AA Sequence

PVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat andgroen (andgroen) ELISA Kit
MBS7614937-01 48 Well

Rat andgroen (andgroen) ELISA Kit

Sign In for Pricing
View Details
Rat andgroen (andgroen) ELISA Kit
MBS7614937-02 96 Well

Rat andgroen (andgroen) ELISA Kit

Sign In for Pricing
View Details
Rat andgroen (andgroen) ELISA Kit
MBS7614937-03 5x 96 Well

Rat andgroen (andgroen) ELISA Kit

Sign In for Pricing
View Details
Rat andgroen (andgroen) ELISA Kit
MBS7614937-04 10x 96 Well

Rat andgroen (andgroen) ELISA Kit

Sign In for Pricing
View Details
Endoplasmic Reticulum Protein 44 Human Recombinant (ERP44 Human)
PT_40515-01 5 µg

Endoplasmic Reticulum Protein 44 Human Recombinant (ERP44 Human)

Sign In for Pricing
View Details
Endoplasmic Reticulum Protein 44 Human Recombinant (ERP44 Human)
PT_40515-02 25 µg

Endoplasmic Reticulum Protein 44 Human Recombinant (ERP44 Human)

Sign In for Pricing
View Details