IL1R1 Peptide - C-terminal region
IL1R1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CD121A, D2S1473, IL-1R-alpha, IL1R, IL1RA, P80
UniProt
P14778
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IL1R1 Rabbit Polyclonal Antibody (orb333740) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_000868
Preservative
Lyophilized powder
AA Sequence
LELEKIQDYEKMPESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040218-100 1x 100 µL
CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400630-100 1x 100 µL
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681073-100 1x 100 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details