Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ccnl1 Peptide - N-terminal region

Ccnl1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Ania-6a, Ccnl|MGC93069, Ccnl

UniProt

Q9R1Q2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ccnl1 Rabbit Polyclonal Antibody (orb574545) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_446114

Preservative

Lyophilized powder

AA Sequence

MATGQVLFHRFFYSKSFVKHSFEIVAMACINLASKIEEAPRRIRDVINVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr784 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
33440064 1.0 µg DNA

Olfr784 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Porcine EHF lgG ELISA Kit
EPE0140 96 Tests

Porcine EHF lgG ELISA Kit

Sign In for Pricing
View Details
Delta-9-Tetrahydrocannabinol - 50 mg/ml solution in methanol
FT00108-01 10 mg

Delta-9-Tetrahydrocannabinol - 50 mg/ml solution in methanol

Sign In for Pricing
View Details
Delta-9-Tetrahydrocannabinol - 50 mg/ml solution in methanol
FT00108-02 50 mg

Delta-9-Tetrahydrocannabinol - 50 mg/ml solution in methanol

Sign In for Pricing
View Details
Delta-9-Tetrahydrocannabinol - 50 mg/ml solution in methanol
FT00108-03 100 mg

Delta-9-Tetrahydrocannabinol - 50 mg/ml solution in methanol

Sign In for Pricing
View Details
PDE6D sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
36292111 3x 1.0 µg

PDE6D sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details