Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rac2 Peptide - C-terminal region

Rac2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI323801, AI452260

UniProt

Q05144

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rac2 Rabbit Polyclonal Antibody (orb331061) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033034

Preservative

Lyophilized powder

AA Sequence

LALAKDIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRPCSLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzyl Hydroxy(4-phenylbutyl)phosphinoacetate
TRC-B279945-2G 2 g

Benzyl Hydroxy(4-phenylbutyl)phosphinoacetate

Sign In for Pricing
View Details
Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3242), CF640R conjugate, 0.1mg/mL
BNC403242-100 1x 100 µL

Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3242), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2711), CF640R conjugate, 0.1mg/mL
BNC402711-100 1x 100 µL

Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2711), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Uterus
CS800082 5x 5 µm

Tissue FFPE Sections, Uterus

Sign In for Pricing
View Details
Hemopexin (HPX) Rabbit Polyclonal Antibody
TA360978 100 µL

Hemopexin (HPX) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Col18a1 (C-term) Rabbit Polyclonal Antibody
AP08511PU-N 50 µg

Col18a1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details