Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rac2 Peptide - C-terminal region

Rac2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI323801, AI452260

UniProt

Q05144

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rac2 Rabbit Polyclonal Antibody (orb331061) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033034

Preservative

Lyophilized powder

AA Sequence

LALAKDIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRPCSLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMIE (NM_147196) Human Recombinant Protein
TP320050 20 µg

TMIE (NM_147196) Human Recombinant Protein

Sign In for Pricing
View Details
Rat VEGF-A (Vascular Endothelial Cell Growth Factor A) ELISA Kit
E-EL-R2603-01 24 Tests

Rat VEGF-A (Vascular Endothelial Cell Growth Factor A) ELISA Kit

Sign In for Pricing
View Details
Rat VEGF-A (Vascular Endothelial Cell Growth Factor A) ELISA Kit
E-EL-R2603-02 48 Tests

Rat VEGF-A (Vascular Endothelial Cell Growth Factor A) ELISA Kit

Sign In for Pricing
View Details
Rat VEGF-A (Vascular Endothelial Cell Growth Factor A) ELISA Kit
E-EL-R2603-03 96 Tests

Rat VEGF-A (Vascular Endothelial Cell Growth Factor A) ELISA Kit

Sign In for Pricing
View Details
CCR3 Rabbit Monoclonal Antibody [Clone ID: 5E8-G9-B4]
TA385827 200 µg

CCR3 Rabbit Monoclonal Antibody [Clone ID: 5E8-G9-B4]

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS624356 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details