Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Olfr1386 Peptide - C-terminal region

Olfr1386 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MOR256-50

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Olfr1386 Rabbit Polyclonal Antibody (orb326316) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001011741

Preservative

Lyophilized powder

AA Sequence

LQPKSSYSESKGKFVALFYTIVTPMLNPLIYTLRNKDVKGALWKVLGRGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p21 (CDKN1A) Mouse Monoclonal Antibody [Clone ID: OTI4B11]
CF808276 100 µg

p21 (CDKN1A) Mouse Monoclonal Antibody [Clone ID: OTI4B11]

Sign In for Pricing
View Details
Adamtsl1 Mouse Gene Knockout Kit (CRISPR)
KN500867 1 Kit

Adamtsl1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rat CX3CL1 (Chemokine C-X3-C-Motif Ligand 1) ELISA Kit
E-EL-R0385-01 24 Tests

Rat CX3CL1 (Chemokine C-X3-C-Motif Ligand 1) ELISA Kit

Sign In for Pricing
View Details
Rat CX3CL1 (Chemokine C-X3-C-Motif Ligand 1) ELISA Kit
E-EL-R0385-02 48 Tests

Rat CX3CL1 (Chemokine C-X3-C-Motif Ligand 1) ELISA Kit

Sign In for Pricing
View Details
Rat CX3CL1 (Chemokine C-X3-C-Motif Ligand 1) ELISA Kit
E-EL-R0385-03 96 Tests

Rat CX3CL1 (Chemokine C-X3-C-Motif Ligand 1) ELISA Kit

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human IgG,  40nm
GM-07-40 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human IgG, 40nm

Sign In for Pricing
View Details