Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Olfr1386 Peptide - C-terminal region

Olfr1386 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MOR256-50

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Olfr1386 Rabbit Polyclonal Antibody (orb326316) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001011741

Preservative

Lyophilized powder

AA Sequence

LQPKSSYSESKGKFVALFYTIVTPMLNPLIYTLRNKDVKGALWKVLGRGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HUWE1 Recombinant Rabbit Monoclonal Antibody [PSH02-38]
HA721815 100 µL

HUWE1 Recombinant Rabbit Monoclonal Antibody [PSH02-38]

Sign In for Pricing
View Details
Nenf (BC048464) Mouse Tagged ORF Clone
MG201443 10 µg

Nenf (BC048464) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
IFNGR1 Rabbit polyclonal Antibody
ER63732 100 µL

IFNGR1 Rabbit polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS804060 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
ITK Mouse Monoclonal Antibody [Clone ID: 5G6]
AM06655SU-N 100 µL

ITK Mouse Monoclonal Antibody [Clone ID: 5G6]

Sign In for Pricing
View Details
Phenylsuccinic Acid
TRC-P336863-500MG 500 mg

Phenylsuccinic Acid

Sign In for Pricing
View Details