Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Olfr329-ps Peptide - middle region

Olfr329-ps Peptide - middle region

Product Specifications

Product Name Alternative

MOR275-6P, Olfr329

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Olfr329-ps Rabbit Polyclonal Antibody (orb326317) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001011531

Preservative

Lyophilized powder

AA Sequence

TVLRMNSAEGRKKALATCSSHMTVVTLFYGAAVYTYMLPASLHTPEKDMV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

trans-Beta-Ocimene
TRC-O150025-50MG 50 mg

trans-Beta-Ocimene

Sign In for Pricing
View Details
AMPD1 Polyclonal Antibody
E-AB-16156-01 20 µL

AMPD1 Polyclonal Antibody

Sign In for Pricing
View Details
AMPD1 Polyclonal Antibody
E-AB-16156-02 60 µL

AMPD1 Polyclonal Antibody

Sign In for Pricing
View Details
AMPD1 Polyclonal Antibody
E-AB-16156-03 120 µL

AMPD1 Polyclonal Antibody

Sign In for Pricing
View Details
AMPD1 Polyclonal Antibody
E-AB-16156-04 200 µL

AMPD1 Polyclonal Antibody

Sign In for Pricing
View Details
1-Ethyl-3-bromoadamantane
TRC-E900280-250MG 250 mg

1-Ethyl-3-bromoadamantane

Sign In for Pricing
View Details