Olfr329-ps Peptide - middle region
Olfr329-ps Peptide - middle region
Product Specifications
Product Name Alternative
MOR275-6P, Olfr329
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Olfr329-ps Rabbit Polyclonal Antibody (orb326317) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001011531
Preservative
Lyophilized powder
AA Sequence
TVLRMNSAEGRKKALATCSSHMTVVTLFYGAAVYTYMLPASLHTPEKDMV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP313652L 1 mg
Epsin 2 (EPN2) (NM_014964) Human Recombinant Protein
Sign In for Pricing
View Details 
BNC042032-100 1x 100 µL
Biotin (Vitamin B7 or Vitamin H) (BTN/2032R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
H3770-CSTF 1 Each
Clamp set for H3770 Chemically resistant/inert teflon, includes rod and clamp
Sign In for Pricing
View Details ![UPRT Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D12]](https://cdn.genprice.uk/products/937/68dd1b82061270361ea1f1e0/imageurl/ta809847am.webp)
TA809847AM 100 µL
UPRT Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D12]
Sign In for Pricing
View Details