Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aacs Peptide - middle region

Aacs Peptide - middle region

Product Specifications

Product Name Alternative

2210408B16Rik, SUR5

UniProt

Q9D2R0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Aacs Rabbit Polyclonal Antibody (orb584814) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_084486

Preservative

Lyophilized powder

AA Sequence

ASGELVCTKPIPCQPTHFWNDENGSKYRKAYFSKFPGVWAHGDYCRINPK

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Alpha-actinin-2, Actn2 ELISA KIT
ELI-35117m 96 Tests

Mouse Alpha-actinin-2, Actn2 ELISA KIT

Sign In for Pricing
View Details
Lentiviral mouse Plaa shRNA (UAS) - Lentiviral mouse Plaa shRNA (UAS, iRFP) (100)
GTR15216627 1 Vial

Lentiviral mouse Plaa shRNA (UAS) - Lentiviral mouse Plaa shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
FGF1 antibody
38145-01 50 µL

FGF1 antibody

Sign In for Pricing
View Details
FGF1 antibody
38145-02 100 µL

FGF1 antibody

Sign In for Pricing
View Details
Olfr1047 ORF Vector (Mouse) (pORF)
ORF052010 1.0 µg DNA

Olfr1047 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Eotaxin 2 (MaxLight 750)
MBS6474144-01 0.1 mL

Eotaxin 2 (MaxLight 750)

Sign In for Pricing
View Details