Aacs Peptide - middle region
Aacs Peptide - middle region
Product Specifications
Product Name Alternative
2210408B16Rik, SUR5
UniProt
Q9D2R0
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Aacs Rabbit Polyclonal Antibody (orb584814) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_084486
Preservative
Lyophilized powder
AA Sequence
ASGELVCTKPIPCQPTHFWNDENGSKYRKAYFSKFPGVWAHGDYCRINPK
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2024995-01 24 Strip Well
Human Fc Fragment Of IgG Low Affinity IIb, Receptor (FcgR2B) ELISA Kit
Sign In for Pricing
View Details 
MBS2024995-02 48 Well
Human Fc Fragment Of IgG Low Affinity IIb, Receptor (FcgR2B) ELISA Kit
Sign In for Pricing
View Details 
MBS2024995-03 96 Well
Human Fc Fragment Of IgG Low Affinity IIb, Receptor (FcgR2B) ELISA Kit
Sign In for Pricing
View Details MBS2024995-04 5x 96 Well
Human Fc Fragment Of IgG Low Affinity IIb, Receptor (FcgR2B) ELISA Kit
Sign In for Pricing
View Details MBS2024995-05 10x 96 Well
Human Fc Fragment Of IgG Low Affinity IIb, Receptor (FcgR2B) ELISA Kit
Sign In for Pricing
View Details