Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H3f3a Peptide - N-terminal region

H3f3a Peptide - N-terminal region

Product Specifications

Product Name Alternative

H3.3A, H3f3b, MGC102150

UniProt

P84244

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with H3f3a Rabbit Polyclonal Antibody (orb584864) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032236

Preservative

Lyophilized powder

AA Sequence

KSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Caulobacter crescentus Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] (glmS), partial
MBS1432634 Inquire

Recombinant Caulobacter crescentus Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] (glmS), partial

Sign In for Pricing
View Details
Anti-Human MSC Polyclonal Antibody
PHA97701 100 μg

Anti-Human MSC Polyclonal Antibody

Sign In for Pricing
View Details
FBXO5 Recombinant Antibody
bsm-61974R-TR 20 µL

FBXO5 Recombinant Antibody

Sign In for Pricing
View Details
Recombinant Synechococcus sp. 33 kDa chaperonin (hslO)
MBS1390529-01 0.02 mg (E-Coli)

Recombinant Synechococcus sp. 33 kDa chaperonin (hslO)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. 33 kDa chaperonin (hslO)
MBS1390529-02 0.02 mg (Yeast)

Recombinant Synechococcus sp. 33 kDa chaperonin (hslO)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. 33 kDa chaperonin (hslO)
MBS1390529-03 0.1 mg (E-Coli)

Recombinant Synechococcus sp. 33 kDa chaperonin (hslO)

Sign In for Pricing
View Details