Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hprt Peptide - C-terminal region

Hprt Peptide - C-terminal region

Product Specifications

Product Name Alternative

C81579, HPGRT, Hprt1, MGC103149

UniProt

P00492

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hprt Rabbit Polyclonal Antibody (orb584881) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038584

Preservative

Lyophilized powder

AA Sequence

SRSVGYRPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TXNDC5 Antibody
A64545-50UL 50 μL

TXNDC5 Antibody

Sign In for Pricing
View Details
Mouse Tissue factor CLIA Kit
MBS8426224-01 1 Kit

Mouse Tissue factor CLIA Kit

Sign In for Pricing
View Details
Mouse Tissue factor CLIA Kit
MBS8426224-02 5x 1 Kit

Mouse Tissue factor CLIA Kit

Sign In for Pricing
View Details
PLCL1 Human qPCR Template Standard (NM_006226)
HK209829 1 Kit

PLCL1 Human qPCR Template Standard (NM_006226)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Annexin A3 (ANXA3)
MBS2147979-01 0.1 mL

APC-Linked Monoclonal Antibody to Annexin A3 (ANXA3)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Annexin A3 (ANXA3)
MBS2147979-02 0.2 mL

APC-Linked Monoclonal Antibody to Annexin A3 (ANXA3)

Sign In for Pricing
View Details