Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hprt Peptide - C-terminal region

Hprt Peptide - C-terminal region

Product Specifications

Product Name Alternative

C81579, HPGRT, Hprt1, MGC103149

UniProt

P00492

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hprt Rabbit Polyclonal Antibody (orb584881) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038584

Preservative

Lyophilized powder

AA Sequence

SRSVGYRPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal espin Antibody
NBP2-55817-25ul 25 µL

Rabbit Polyclonal espin Antibody

Sign In for Pricing
View Details
N- (3-Chloropropyl) acetamide
OR1068897-01 50 mg

N- (3-Chloropropyl) acetamide

Sign In for Pricing
View Details
N- (3-Chloropropyl) acetamide
OR1068897-02 100 mg

N- (3-Chloropropyl) acetamide

Sign In for Pricing
View Details
N- (3-Chloropropyl) acetamide
OR1068897-03 250 mg

N- (3-Chloropropyl) acetamide

Sign In for Pricing
View Details
N- (3-Chloropropyl) acetamide
OR1068897-04 1 g

N- (3-Chloropropyl) acetamide

Sign In for Pricing
View Details
SRIP3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV749540 1.0 µg DNA

SRIP3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details