Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Map2k1 Peptide - C-terminal region

Map2k1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MAPKK1, MEKK1, Mek1, Prkmk1

UniProt

Q9JJE1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Map2k1 Rabbit Polyclonal Antibody (orb584883) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032953

Preservative

Lyophilized powder

AA Sequence

LIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQPSTPTHAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rac-2-Palmitoyl-1-oleoyl-3-chloropropanediol-d5
TRC-P160517-10MG 10 mg

rac-2-Palmitoyl-1-oleoyl-3-chloropropanediol-d5

Sign In for Pricing
View Details
Calcitonin receptor (CALCR) (NM_001164737) Human Over-expression Lysate
LY431447 100 µg

Calcitonin receptor (CALCR) (NM_001164737) Human Over-expression Lysate

Sign In for Pricing
View Details
TP53I11 Polyclonal Antibody
E-AB-16935-01 20 µL

TP53I11 Polyclonal Antibody

Sign In for Pricing
View Details
TP53I11 Polyclonal Antibody
E-AB-16935-02 60 µL

TP53I11 Polyclonal Antibody

Sign In for Pricing
View Details
TP53I11 Polyclonal Antibody
E-AB-16935-03 120 µL

TP53I11 Polyclonal Antibody

Sign In for Pricing
View Details
TP53I11 Polyclonal Antibody
E-AB-16935-04 200 µL

TP53I11 Polyclonal Antibody

Sign In for Pricing
View Details