Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stx7 Peptide - N-terminal region

Stx7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AI315064, AI317144, AW107239, Syn7

UniProt

Q9JMJ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Stx7 Rabbit Polyclonal Antibody (orb584898) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058077

Preservative

Lyophilized powder

AA Sequence

ITQCSVEIQRTLNQLGTPQDSPELRQQLQQKQQYTNQLAKETDKYIKEFG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTF1 (NM_005955) Human Recombinant Protein
TP304861M 100 µg

MTF1 (NM_005955) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant CLASP1 Antibody
RC-5231-01 50 μL

Recombinant CLASP1 Antibody

Sign In for Pricing
View Details
Recombinant CLASP1 Antibody
RC-5231-02 100 µL

Recombinant CLASP1 Antibody

Sign In for Pricing
View Details
Recombinant CLASP1 Antibody
RC-5231-03 1 mL

Recombinant CLASP1 Antibody

Sign In for Pricing
View Details
ZNF690 / ZSCAN29 (ZSCAN29/2610), CF594 conjugate, 0.1mg/mL
BNC942610-500 1x 500 µL

ZNF690 / ZSCAN29 (ZSCAN29/2610), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-4 / ERBB4 (HFR-1), CF594 conjugate, 0.1mg/mL
BNC942379-100 1x 100 µL

HER-4 / ERBB4 (HFR-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details