Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab5a Peptide - C-terminal region

Rab5a Peptide - C-terminal region

Product Specifications

Product Name Alternative

2410015H04Rik, AI663973, AU021172

UniProt

Q9CQD1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rab5a Rabbit Polyclonal Antibody (orb584924) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080163

Preservative

Lyophilized powder

AA Sequence

YADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAMSN1 Polyclonal Antibody
E-AB-52918-01 20 µL

SAMSN1 Polyclonal Antibody

Sign In for Pricing
View Details
SAMSN1 Polyclonal Antibody
E-AB-52918-02 60 µL

SAMSN1 Polyclonal Antibody

Sign In for Pricing
View Details
SAMSN1 Polyclonal Antibody
E-AB-52918-03 120 µL

SAMSN1 Polyclonal Antibody

Sign In for Pricing
View Details
SAMSN1 Polyclonal Antibody
E-AB-52918-04 200 µL

SAMSN1 Polyclonal Antibody

Sign In for Pricing
View Details
Ccnk Mouse Gene Knockout Kit (CRISPR)
KN502822 1 Kit

Ccnk Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
VMAT1 (SLC18A1) Human Gene Knockout Kit (CRISPR)
KN421148 1 Kit

VMAT1 (SLC18A1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details