Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab5a Peptide - middle region

Rab5a Peptide - middle region

Product Specifications

Product Name Alternative

2410015H04Rik, AI663973, AU021172

UniProt

Q9CQD1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rab5a Rabbit Polyclonal Antibody (orb584925) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080163

Preservative

Lyophilized powder

AA Sequence

GAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cobalt HTC Agarose Beads
B2015101 25 mL

Cobalt HTC Agarose Beads

Sign In for Pricing
View Details
SEPT1 Rabbit pAb, AE conjugated
orb2871079 100 µL

SEPT1 Rabbit pAb, AE conjugated

Sign In for Pricing
View Details
BCO2 Human shRNA Lentiviral Particle (Locus ID 83875)
TL314496V 500 µL Each

BCO2 Human shRNA Lentiviral Particle (Locus ID 83875)

Sign In for Pricing
View Details
Bovine Olfactory receptor 5D14 (OR5D14) ELISA kit
GTR10423520 96 Well

Bovine Olfactory receptor 5D14 (OR5D14) ELISA kit

Sign In for Pricing
View Details
SKP2 antibody
10R-10371 100 ug

SKP2 antibody

Sign In for Pricing
View Details
Salmonella typhi Monoclonal Antibody
orb1821263 50 µL

Salmonella typhi Monoclonal Antibody

Sign In for Pricing
View Details