Rab5a Peptide - middle region
Rab5a Peptide - middle region
Product Specifications
Product Name Alternative
2410015H04Rik, AI663973, AU021172
UniProt
Q9CQD1
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Rab5a Rabbit Polyclonal Antibody (orb584925) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_080163
Preservative
Lyophilized powder
AA Sequence
GAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7175395 Inquire
Rabbit anti-Escherichia fergusonii (strain 35469/DSM 13698/CDC 0568-73) ISPF Polyclonal Antibody
Sign In for Pricing
View Details 
K2593408 1.0 µg DNA
UQCRH sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
Sign In for Pricing
View Details TL703359V 500 µL Each
Ubac2 Rat shRNA Lentiviral Particle (Locus ID 361094)
Sign In for Pricing
View Details P504183 100 µg
German cockroach Bla g 2/Allergen Bla g II Protein (N-His, Blattella germanica (German cockroach) (Blatta germanica) )
Sign In for Pricing
View Details