Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hsp90aa1 Peptide - C-terminal region

Hsp90aa1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

86kDa, 89kDa, AL024080, AL024147, Hsp86-1, Hsp89, Hsp90, Hspca, hsp4

UniProt

P07901

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hsp90aa1 Rabbit Polyclonal Antibody (orb584943) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034610

Preservative

Lyophilized powder

AA Sequence

ILKVIRKNLVKKCLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXO38 ORF Vector (Human) (pORF)
ORF003972 1.0 µg DNA

FBXO38 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Human Ubiquitin carboxyl-terminal hydrolase 44,USP44 ELISA KIT
ELI-44769h 96 Tests

Human Ubiquitin carboxyl-terminal hydrolase 44,USP44 ELISA KIT

Sign In for Pricing
View Details
PCK2 (FITC)
571633-01 50 µg

PCK2 (FITC)

Sign In for Pricing
View Details
PCK2 (FITC)
571633-02 100 µg

PCK2 (FITC)

Sign In for Pricing
View Details
SUMO2 Protein Vector (Rat) (pPM-C-HA)
PV308976 500 ng

SUMO2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Transmembrane protein FAM155A, Fam155a ELISA KIT
ELI-48536m 96 Tests

Mouse Transmembrane protein FAM155A, Fam155a ELISA KIT

Sign In for Pricing
View Details