Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hsp90aa1 Peptide - C-terminal region

Hsp90aa1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

86kDa, 89kDa, AL024080, AL024147, Hsp86-1, Hsp89, Hsp90, Hspca, hsp4

UniProt

P07901

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hsp90aa1 Rabbit Polyclonal Antibody (orb584943) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034610

Preservative

Lyophilized powder

AA Sequence

ILKVIRKNLVKKCLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXO30 Protein Vector (Mouse) (pPM-C-HA)
PV178660 500 ng

FBXO30 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Sheep Actin, cytoplasmic 1 (ACTB) ELISA Kit
MBS286811-01 48 Tests

Sheep Actin, cytoplasmic 1 (ACTB) ELISA Kit

Sign In for Pricing
View Details
Sheep Actin, cytoplasmic 1 (ACTB) ELISA Kit
MBS286811-02 96 Tests

Sheep Actin, cytoplasmic 1 (ACTB) ELISA Kit

Sign In for Pricing
View Details
Sheep Actin, cytoplasmic 1 (ACTB) ELISA Kit
MBS286811-03 5x 96 Tests

Sheep Actin, cytoplasmic 1 (ACTB) ELISA Kit

Sign In for Pricing
View Details
Sheep Actin, cytoplasmic 1 (ACTB) ELISA Kit
MBS286811-04 10x 96 Tests

Sheep Actin, cytoplasmic 1 (ACTB) ELISA Kit

Sign In for Pricing
View Details
Anti-Ninjurin-1 Polyclonal Antibody
TMAB-01238-01 50 μL

Anti-Ninjurin-1 Polyclonal Antibody

Sign In for Pricing
View Details