Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Asl Peptide - C-terminal region

Asl Peptide - C-terminal region

Product Specifications

Product Name Alternative

2510006M18Rik

UniProt

Q91YI0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Asl Rabbit Polyclonal Antibody (orb584945) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_598529

Preservative

Lyophilized powder

AA Sequence

MPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sgsm3 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4943903 1.0 µg DNA

Sgsm3 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
ASZ1 Protein Vector (Rat) (pPM-C-HA)
PV255008 500 ng

ASZ1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Sirtuin 3 (SIRT3)
MBS2075784-01 0.1 mL

PE-Linked Polyclonal Antibody to Sirtuin 3 (SIRT3)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Sirtuin 3 (SIRT3)
MBS2075784-02 0.2 mL

PE-Linked Polyclonal Antibody to Sirtuin 3 (SIRT3)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Sirtuin 3 (SIRT3)
MBS2075784-03 0.5 mL

PE-Linked Polyclonal Antibody to Sirtuin 3 (SIRT3)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Sirtuin 3 (SIRT3)
MBS2075784-04 1 mL

PE-Linked Polyclonal Antibody to Sirtuin 3 (SIRT3)

Sign In for Pricing
View Details