Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Asl Peptide - C-terminal region

Asl Peptide - C-terminal region

Product Specifications

Product Name Alternative

2510006M18Rik

UniProt

Q91YI0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Asl Rabbit Polyclonal Antibody (orb584945) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_598529

Preservative

Lyophilized powder

AA Sequence

MPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD331/FGFR1 Protein, N-His
orb2836464-01 20 µg

Recombinant Human CD331/FGFR1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD331/FGFR1 Protein, N-His
orb2836464-02 50 µg

Recombinant Human CD331/FGFR1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD331/FGFR1 Protein, N-His
orb2836464-03 100 µg

Recombinant Human CD331/FGFR1 Protein, N-His

Sign In for Pricing
View Details
Marco Mouse siRNA Oligo Duplex (Locus ID 17167)
SR416545 1 Kit

Marco Mouse siRNA Oligo Duplex (Locus ID 17167)

Sign In for Pricing
View Details
Golga7b (NM_001141983) Mouse Tagged ORF Clone Lentiviral Particle
MR221178L3V 200 µL

Golga7b (NM_001141983) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Stable VERO Overexpressing HER2 Cell Line
T3189 1x106 cells / 1.0 mL

Stable VERO Overexpressing HER2 Cell Line

Sign In for Pricing
View Details