Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Entpd1 Peptide - N-terminal region

Entpd1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2610206B08Rik, AA408691, Cd39, NTPDase-1

UniProt

P55772

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Entpd1 Rabbit Polyclonal Antibody (orb584953) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033978

Preservative

Lyophilized powder

AA Sequence

YGIVLDAGSSHTNLYIYKWPAEKENDTGVVQQLEECQVKGPGISKYAQKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MGAT2 Rabbit pAb
GB115150-100 100 μL

Anti-MGAT2 Rabbit pAb

Sign In for Pricing
View Details
UBE2L3 Antibody
CSB-PA025463LA01HU-01 50 µg

UBE2L3 Antibody

Sign In for Pricing
View Details
UBE2L3 Antibody
CSB-PA025463LA01HU-02 100 µg

UBE2L3 Antibody

Sign In for Pricing
View Details
RPL7A Recombinant Rabbit Monoclonal Antibody [JE54-45]
ET7110-70 100 µL

RPL7A Recombinant Rabbit Monoclonal Antibody [JE54-45]

Sign In for Pricing
View Details
PLEKHG4 (Puratrophin-1, Pleckstrin Homology Domain-containing Family G Member 4, PH Domain-containing Family G Member 4, Purkinje Cell Atrophy-associated Protein 1, PRTPHN1, ARHGEF44, DKFZp434I216, DKFZP434I216, SCA4) (MaxLight 750)
MBS6389766-01 0.1 mL

PLEKHG4 (Puratrophin-1, Pleckstrin Homology Domain-containing Family G Member 4, PH Domain-containing Family G Member 4, Purkinje Cell Atrophy-associated Protein 1, PRTPHN1, ARHGEF44, DKFZp434I216, DKFZP434I216, SCA4) (MaxLight 750)

Sign In for Pricing
View Details
PLEKHG4 (Puratrophin-1, Pleckstrin Homology Domain-containing Family G Member 4, PH Domain-containing Family G Member 4, Purkinje Cell Atrophy-associated Protein 1, PRTPHN1, ARHGEF44, DKFZp434I216, DKFZP434I216, SCA4) (MaxLight 750)
MBS6389766-02 5x 0.1 mL

PLEKHG4 (Puratrophin-1, Pleckstrin Homology Domain-containing Family G Member 4, PH Domain-containing Family G Member 4, Purkinje Cell Atrophy-associated Protein 1, PRTPHN1, ARHGEF44, DKFZp434I216, DKFZP434I216, SCA4) (MaxLight 750)

Sign In for Pricing
View Details