Rps6 Peptide - C-terminal region
Rps6 Peptide - C-terminal region
Product Specifications
UniProt
P62755
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Rps6 Rabbit Polyclonal Antibody (orb585017) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_058856
Preservative
Lyophilized powder
AA Sequence
KEGKKPRTKAPKIQRLVTPRVLQHKRRRIALKKQRTKKNKEEAAEYAKLL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC471457-500 1x 500 µL
PDCD1 / PD1 / CD279 (Programmed Cell Death 1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![TIA1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D7]](https://cdn.genprice.uk/products/937/68dd1b76061270361ea1a718/imageurl/ta800657am.webp)
TA800657AM 100 µL
TIA1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D7]
Sign In for Pricing
View Details 
AP02310PU-N 100 µL
MEK2 (MAP2K2) pThr394 Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
