Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rps6 Peptide - C-terminal region

Rps6 Peptide - C-terminal region

Product Specifications

UniProt

P62755

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rps6 Rabbit Polyclonal Antibody (orb585017) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058856

Preservative

Lyophilized powder

AA Sequence

KEGKKPRTKAPKIQRLVTPRVLQHKRRRIALKKQRTKKNKEEAAEYAKLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS501088 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Human ODF2 activation kit by CRISPRa
GA103310 1 Kit

Human ODF2 activation kit by CRISPRa

Sign In for Pricing
View Details
PSMA3 (NM_002788) Human Recombinant Protein
TP305917L 1 mg

PSMA3 (NM_002788) Human Recombinant Protein

Sign In for Pricing
View Details
Malondialdehyde (MDA) Colorimetric Assay Kit (Plant Samples)
E-BC-K027-S-01 50 Assays (36 samples)

Malondialdehyde (MDA) Colorimetric Assay Kit (Plant Samples)

Sign In for Pricing
View Details
Malondialdehyde (MDA) Colorimetric Assay Kit (Plant Samples)
E-BC-K027-S-02 100 Assays (86 samples)

Malondialdehyde (MDA) Colorimetric Assay Kit (Plant Samples)

Sign In for Pricing
View Details
HRH3 Human Gene Knockout Kit (CRISPR)
KN418388 1 Kit

HRH3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details