Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rpl26 Peptide - middle region

Rpl26 Peptide - middle region

Product Specifications

Product Name Alternative

SIG-20

UniProt

Q3U7N1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rpl26 Rabbit Polyclonal Antibody (orb585065) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033106

Preservative

Lyophilized powder

AA Sequence

GQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bromodan-d5
TRC-B682812-100MG 100 mg

Bromodan-d5

Sign In for Pricing
View Details
4-Nitrophenyl 2-(Acetamido)-2-deoxy-3-O-Beta-D-galactopyranosyl-Alpha-D-galactopyranoside
TRC-N501000-1MG 1 mg

4-Nitrophenyl 2-(Acetamido)-2-deoxy-3-O-Beta-D-galactopyranosyl-Alpha-D-galactopyranoside

Sign In for Pricing
View Details
tert-Butyl Acrylate (Stabilized with MEHQ)
TRC-B690506-5ML 5 mL

tert-Butyl Acrylate (Stabilized with MEHQ)

Sign In for Pricing
View Details
4-Fmoc-3(R)-morpholinecarboxylic Acid
TRC-F648480-1G 1 g

4-Fmoc-3(R)-morpholinecarboxylic Acid

Sign In for Pricing
View Details
Btbd11 Mouse Gene Knockout Kit (CRISPR)
KN502294 1 Kit

Btbd11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EFHD1 Monoclonal Antibody
E-AB-22043-01 20 µL

EFHD1 Monoclonal Antibody

Sign In for Pricing
View Details