Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Epha4 Peptide - C-terminal region

Epha4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2900005C20Rik, AI385584, Cek8, Hek8, Sek, Sek1, Tyro1, rb

UniProt

Q03137

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Epha4 Rabbit Polyclonal Antibody (orb585080) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_031962

Preservative

Lyophilized powder

AA Sequence

VISRRRSKYSKAKQEADEEKHLNQGVRTYVDPFTYEDPNQAVREFAKEID

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NK314 100mg
A13993-100 100 mg

NK314 100mg

Sign In for Pricing
View Details
Human KLK6 Recombinant Protein
PPT-13543 100 µg

Human KLK6 Recombinant Protein

Sign In for Pricing
View Details
Mouse Monoclonal STAT5b Antibody (STAT5B/2657) [DyLight 488]
NBP3-08628G 100 µL

Mouse Monoclonal STAT5b Antibody (STAT5B/2657) [DyLight 488]

Sign In for Pricing
View Details
Nadkd1 AAV siRNA Pooled Vector
31394166 1.0 µg

Nadkd1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Recombinant Mouse Translocation protein SEC62 (Sec62), partial
MBS7092192 Inquire

Recombinant Mouse Translocation protein SEC62 (Sec62), partial

Sign In for Pricing
View Details
Research Grade Bepranemab
MBS1563486-01 0.1 mg

Research Grade Bepranemab

Sign In for Pricing
View Details