Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK11A Peptide - C-terminal region

CDK11A Peptide - C-terminal region

Product Specifications

Product Name Alternative

CDC2L2, CDC2L3, p58GTA, PITSLRE, CDK11-p46, CDK11-p58, CDK11-p110

UniProt

Q9UQ88

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDK11A Rabbit Polyclonal Antibody (orb331151) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_277071

Preservative

Lyophilized powder

AA Sequence

EYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nos3 Antibody Pair
MBS7042018-01 1 Pair (Sufficient for 5x96 well plates)

Nos3 Antibody Pair

Sign In for Pricing
View Details
Nos3 Antibody Pair
MBS7042018-02 5x 1 Pair (Sufficient for 25x 96 Well Plates)

Nos3 Antibody Pair

Sign In for Pricing
View Details
PDE6delta inhibitor 8
MBS3603259 Inquire

PDE6delta inhibitor 8

Sign In for Pricing
View Details
Porcine Choline acetyltransferase ELISA kit
GTR10397654 96 Well

Porcine Choline acetyltransferase ELISA kit

Sign In for Pricing
View Details
Fcgr1a ORF Vector (Rat) (pORF)
ORF067039 1.0 µg DNA

Fcgr1a ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Robo3 Rat siRNA Oligo Duplex (Locus ID 315564)
SR502033 1 Kit

Robo3 Rat siRNA Oligo Duplex (Locus ID 315564)

Sign In for Pricing
View Details