Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK11A Peptide - C-terminal region

CDK11A Peptide - C-terminal region

Product Specifications

Product Name Alternative

CDC2L2, CDC2L3, p58GTA, PITSLRE, CDK11-p46, CDK11-p58, CDK11-p110

UniProt

Q9UQ88

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDK11A Rabbit Polyclonal Antibody (orb331151) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_277071

Preservative

Lyophilized powder

AA Sequence

EYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Psma7 sgRNA CRISPR Lentivector set (Mouse)
K4486601 3x 1.0 µg

Psma7 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Rabbit Polyclonal CCDC144A Antibody
NBP2-55601 100 µL

Rabbit Polyclonal CCDC144A Antibody

Sign In for Pricing
View Details
Rabbit Anti ADAMTS18 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(IHC, ELISA)
MBS8422221-01 0.001 mL

Rabbit Anti ADAMTS18 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(IHC, ELISA)

Sign In for Pricing
View Details
Rabbit Anti ADAMTS18 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(IHC, ELISA)
MBS8422221-02 5x 0.001 mL

Rabbit Anti ADAMTS18 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(IHC, ELISA)

Sign In for Pricing
View Details
Olprinone
BA8207-10 10 mg

Olprinone

Sign In for Pricing
View Details
Recombinant Human ARPC4 Protein, N-His
orb2835664-01 20 µg

Recombinant Human ARPC4 Protein, N-His

Sign In for Pricing
View Details