Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rpl37 Peptide - middle region

Rpl37 Peptide - middle region

Product Specifications

Product Name Alternative

3110005M08Rik

UniProt

Q9D823

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rpl37 Rabbit Polyclonal Antibody (orb585159) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080345

Preservative

Lyophilized powder

AA Sequence

YNWSAKAKRRNTTGTGRMRHLKIVYRRFRHGFREGTTPKPKRAAVAASSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNPLA4 (NM_001142389) Human Over-expression Lysate
LY428061 100 µg

PNPLA4 (NM_001142389) Human Over-expression Lysate

Sign In for Pricing
View Details
GLG1 (Golgi Complex) (GLG1/970), Biotin conjugate, 0.1mg/mL
BNCB0970-100 1x 100 µL

GLG1 (Golgi Complex) (GLG1/970), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1,3-Bis(1-naphthalenyloxy)-2-propanol
TRC-B504300-5G 5 g

1,3-Bis(1-naphthalenyloxy)-2-propanol

Sign In for Pricing
View Details
Cytokeratin, HMW (KRTH/1076), CF568 conjugate, 0.1mg/mL
BNC681076-500 1x 500 µL

Cytokeratin, HMW (KRTH/1076), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BMP10 Rabbit Polyclonal Antibody
TA374025 100 µL

BMP10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
QuicKey Pro Human Pg (Progesterone) ELISA Kit
E-OSEL-H0011-01 24 Tests

QuicKey Pro Human Pg (Progesterone) ELISA Kit

Sign In for Pricing
View Details