Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ccdc6 Peptide - N-terminal region

Ccdc6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2810012H18Rik, AA536681, AA960498, AW061011

UniProt

D3YZP9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ccdc6 Rabbit Polyclonal Antibody (orb585163) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001104591

Preservative

Lyophilized powder

AA Sequence

LASLQQENKVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDGFB Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
36302061 1.0 µg DNA

PDGFB Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Anti-Osteocalcin (OC)
FY-AB48837-01 1 mL

Anti-Osteocalcin (OC)

Sign In for Pricing
View Details
Anti-Osteocalcin (OC)
FY-AB48837-02 100 µL

Anti-Osteocalcin (OC)

Sign In for Pricing
View Details
Anti-Osteocalcin (OC)
FY-AB48837-03 200 µL

Anti-Osteocalcin (OC)

Sign In for Pricing
View Details
Histone H1.4 Rabbit Polyclonal Antibody (Cy5.5)
orb1061301 100 µL

Histone H1.4 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Rabbit Polyclonal FAM212A Antibody [DyLight 650]
NBP3-05938C 0.1 mL

Rabbit Polyclonal FAM212A Antibody [DyLight 650]

Sign In for Pricing
View Details