Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eif4a1 Peptide - C-terminal region

Eif4a1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BM-010, Ddx2a, Eif4

UniProt

P60843

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Eif4a1 Rabbit Polyclonal Antibody (orb585168) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659207

Preservative

Lyophilized powder

AA Sequence

AVIFINTRRKVDWLTEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRNA-CD8B
LS-RMCar-002 1 mg

MRNA-CD8B

Sign In for Pricing
View Details
SH2D7 Human Over-expression Lysate
orb1341463 100 µg

SH2D7 Human Over-expression Lysate

Sign In for Pricing
View Details
AdmiRa-mmu-mir-466o Virus
mm2153 250 µL

AdmiRa-mmu-mir-466o Virus

Sign In for Pricing
View Details
ABCE1 Rabbit mAb
MBS8602133-01 0.1 mL

ABCE1 Rabbit mAb

Sign In for Pricing
View Details
ABCE1 Rabbit mAb
MBS8602133-02 0.1 mL (AF405L)

ABCE1 Rabbit mAb

Sign In for Pricing
View Details
ABCE1 Rabbit mAb
MBS8602133-03 0.1 mL (AF405S)

ABCE1 Rabbit mAb

Sign In for Pricing
View Details