Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eif4a1 Peptide - C-terminal region

Eif4a1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BM-010, Ddx2a, Eif4

UniProt

P60843

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Eif4a1 Rabbit Polyclonal Antibody (orb585168) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659207

Preservative

Lyophilized powder

AA Sequence

AVIFINTRRKVDWLTEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse TCR Vgamma 3 Antibody (536), FITC
MBS1586133-01 50 Tests

Anti-Mouse TCR Vgamma 3 Antibody (536), FITC

Sign In for Pricing
View Details
Anti-Mouse TCR Vgamma 3 Antibody (536), FITC
MBS1586133-02 100 Tests

Anti-Mouse TCR Vgamma 3 Antibody (536), FITC

Sign In for Pricing
View Details
Anti-Mouse TCR Vgamma 3 Antibody (536), FITC
MBS1586133-03 5x 100 Tests

Anti-Mouse TCR Vgamma 3 Antibody (536), FITC

Sign In for Pricing
View Details
XKRX Protein Vector (Mouse) (pPM-C-His)
PV247793 500 ng

XKRX Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Neratinib Impurity 18
RM-N051818-01 10 mg

Neratinib Impurity 18

Sign In for Pricing
View Details
Neratinib Impurity 18
RM-N051818-02 25 mg

Neratinib Impurity 18

Sign In for Pricing
View Details